HPA026911

TMPRSS11F antibody from Atlas Antibodies
FLJ16046
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026911, RRID:AB_2205589
Product name
Anti-TMPRSS11F
Provider product page
Atlas Antibodies - HPA026911
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKDPTQWIATFGATITPPAVKRNVRKIILHENYHR
ETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLP
PKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDV
CNRKDVYDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -