HPA026911

TMPRSS11F antibody from Sigma-Aldrich
FLJ16046
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026911, RRID:AB_2205589
Product name
Anti-TMPRSS11F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026911
Antibody type
Polyclonal
Antigen
Transmembrane protease, serine 11F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKDPTQWIATFGATITPPAVKRNVRKIILHENYHR
ETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLP
PKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDV
CNRKDVYDG
Storage
-20C
Provider Type Product Number
- No reagents -