H00063974-M04A

NEUROD6 antibody from Abnova Corporation
Atoh2, bHLHa2, Math-2, Nex1, NEX1M
No application information provided.

Antibody data

Product number
H00063974-M04A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063974-M04A, RRID:AB_10759283
Product name
NEUROD6 monoclonal antibody (M04A), clone 1B5
Provider product page
Abnova Corporation - H00063974-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NEUROD6.
Antigen sequence
GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTL
DNSKSMKPYNYCSAYESFYESTSPECASPQFEGPL
SPPPINYNGIFSLKQEETLDYGKNYNYGMH
Isotype
IgG
Antibody clone number
1B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -