ABIN182567

antibody from antibodies-online

Targeting: NEUROD6 Atoh2, bHLHa2, Math-2, Nex1, NEX1M

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN182567

Provider

antibodies-online

Product name

anti-Neurogenic Differentiation 6 (NEUROD6) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-NEUROD6 antibody: synthetic peptide directed towards the N terminal of human NEUROD6

Reactivity

Human, Mouse, Rat, Bovine, Canine, Chicken/Avian

Host

Rabbit

Antigen sequence

MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRA
PGEET EKEEEEEDRE


Vial size

50 µg

References

Submitted references

Human chromosome 7: DNA sequence and biology.

Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Döhner H, Döhner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC
Science (New York, N.Y.) 2003 May 2;300(5620):767-72

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Image(s): Western Blotting