HPA015305

TNRC6A antibody from Sigma-Aldrich
CAGH26, GW182, KIAA1460, TNRC6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015305
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015305, RRID:AB_1850454
Product name
Anti-TNRC6A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015305
Antibody type
Polyclonal
Antigen
Trinucleotide repeat-containing gene 6A protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSVGPQALSKSGPKSMQDGWCGDDMPLPGNRPTGW
EEEEDVEIGMWNSNSSQELNSSLNWPPYTKKMSSK
GLSGKKRRRERGMMKGGNKQEEAWINPFVKQFSNI
SFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSL
NIGDYNRTV
Storage
-20C
Provider Type Product Number
- No reagents -