HPA017869

TNRC6A antibody from Atlas Antibodies
CAGH26, GW182, KIAA1460, TNRC6

Antibody data

Product number
HPA017869
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017869, RRID:AB_1850456
Product name
Anti-TNRC6A
Provider product page
Atlas Antibodies - HPA017869
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSV
QQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMK
SFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNL
NVNMDMNSIKEPQSRLRKWT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.