HPA005640

NDUFB5 antibody from Atlas Antibodies
CI-SGDH, MGC12314, SGDH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005640
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005640, RRID:AB_1079461
Product name
Anti-NDUFB5
Provider product page
Atlas Antibodies - HPA005640
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTM
AVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYE
TIDKELIDHSPKATPDN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -