Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030267 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030267, RRID:AB_10610004
- Product name
- Anti-LGR4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADE
EDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNL
PRVKD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references LGR4 and LGR5 Regulate Hair Cell Differentiation in the Sensory Epithelium of the Developing Mouse Cochlea
LGR4 and LGR6 are differentially expressed and of putative tumor biological significance in gastric carcinoma
Żak M, van Oort T, Hendriksen F, Garcia M, Vassart G, Grolman W
Frontiers in Cellular Neuroscience 2016;10
Frontiers in Cellular Neuroscience 2016;10
LGR4 and LGR6 are differentially expressed and of putative tumor biological significance in gastric carcinoma
Steffen J, Simon E, Warneke V, Balschun K, Ebert M, Röcken C
Virchows Archiv 2012;461(4):355-365
Virchows Archiv 2012;461(4):355-365
No comments: Submit comment
No validations: Submit validation data