Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004729-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004729-M03, RRID:AB_1111982
- Product name
- NDUFV2 monoclonal antibody (M03), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDUFV2.
- Antigen sequence
EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAP
MVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPR
SGRFSCEPAGGLTSLTEPPKGPGFGVQAGL- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NDUFV2 monoclonal antibody (M03), clone 1A10. Western Blot analysis of NDUFV2 expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 monoclonal antibody (M03), clone 1A10.Lane 1: NDUFV2 transfected lysate (Predicted MW: 27.4 KDa).Lane 2: Non-transfected lysate.