Antibody data

Product number
H00004729-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004729-M03, RRID:AB_1111982
Product name
NDUFV2 monoclonal antibody (M03), clone 1A10
Provider product page
Abnova Corporation - H00004729-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NDUFV2.
Antigen sequence
EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAP
MVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPR
SGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Isotype
IgG
Antibody clone number
1A10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -