HPA003404

NDUFV2 antibody from Sigma-Aldrich
CI-24k
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003404
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003404, RRID:AB_1079466
Product name
Anti-NDUFV2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003404
Antibody type
Polyclonal
Antigen
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVL
QVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPC
MLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVE
CLGACVNAPMVQINDNYYEDLTAKDIEE
Storage
-20C
Provider Type Product Number
- No reagents -