HPA020979

KLHL42 antibody from Atlas Antibodies
Ctb9, KIAA1340, KLHDC5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020979, RRID:AB_1852559
Product name
Anti-KLHL42
Provider product page
Atlas Antibodies - HPA020979
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CKPQFHLLGSPPQAPGDVSLKQRLREARMTGTPVL
VALGDFLGGPLAPHPYQGEPPSMLRYEEMTERWFP
LANNLPPDLVNVRGYG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -