HPA020979

KLHL42 antibody from Sigma-Aldrich
Ctb9, KIAA1340, KLHDC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020979, RRID:AB_1852559
Product name
Anti-KLHDC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020979
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CKPQFHLLGSPPQAPGDVSLKQRLREARMTGTPVL
VALGDFLGGPLAPHPYQGEPPSMLRYEEMTERWFP
LANNLPPDLVNVRGYG
Storage
-20C
Provider Type Product Number
- No reagents -