HPA003405

IVNS1ABP antibody from Atlas Antibodies
ARA3, HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003405
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003405, RRID:AB_1079141
Product name
Anti-IVNS1ABP
Provider product page
Atlas Antibodies - HPA003405
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYN
REECLRTVECYNPHTDHWSFLAPMRTPRARFQMAV
LMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVP
ELRTNRCNAGVCALNGKLYIVGGSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -