ABIN1107888
antibody from antibodies-online
Targeting: IVNS1ABP
ARA3, HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107888 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPE
AVEVLLNYAYTAQLK- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references NS1-Binding protein (NS1-BP): a novel human protein that interacts with the influenza A virus nonstructural NS1 protein is relocalized in the nuclei of infected cells.
Wolff T, O'Neill RE, Palese P
Journal of virology 1998 Sep;72(9):7170-80
Journal of virology 1998 Sep;72(9):7170-80
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human K562; WB Suggested Anti-IVNS1ABP Antibody Titration: 0.2-1 ug/ml. Positive Control: K562 cell lysate; IVNS1ABP antibody - N-terminal region (AP42175PU-N) in Human K562 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Liver; IVNS1ABP antibody - N-terminal region (AP42175PU-N) in Human Liver cells using Immunohistochemistry