HPA026756

CARNMT1 antibody from Sigma-Aldrich
C9orf41, FLJ25795
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026756
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026756, RRID:AB_1845824
Product name
Anti-C9orf41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026756
Antibody type
Polyclonal
Antigen
UPF0586 protein C9orf41 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEERLEREHFWKIINAFRYYGTSMHERVNRTERQF
RSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTI
VNDCIHMFENKEYGEDGNGKIMPASTFDMDKLKST
LKQFVRDWSETGKAER
Storage
-20C
Provider Type Product Number
- No reagents -