Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503409 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Family with Sequence Similarity 161, Member B (FAM161B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C14orf44 antibody: synthetic peptide directed towards the middle region of human C14orf44
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELE
EMKQR IQTRPYLFEQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
Adams MD, Kerlavage AR, Fleischmann RD, Fuldner RA, Bult CJ, Lee NH, Kirkness EF, Weinstock KG, Gocayne JD, White O
Nature 1995 Sep 28;377(6547 Suppl):3-174
Nature 1995 Sep 28;377(6547 Suppl):3-174
No comments: Submit comment
No validations: Submit validation data