HPA019125

FAM161B antibody from Sigma-Aldrich
C14orf44, FLJ31697
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019125
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019125, RRID:AB_1845570
Product name
Anti-FAM161B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019125
Antibody type
Polyclonal
Antigen
UPF0564 protein FAM161B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSRQIFPPESFADTEAGEELSGDGLVLPRASKLDE
FLSPEEEIDSTSDSTGSIYQNLQELKQKGRWCLLE
SLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQ
CPQALRCGSTRRCSSLNNLPSNIPRPQTQPPS
Storage
-20C
Provider Type Product Number
- No reagents -