HPA019125

FAM161B antibody from Atlas Antibodies
C14orf44, FLJ31697
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019125
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019125, RRID:AB_1845570
Product name
Anti-FAM161B
Provider product page
Atlas Antibodies - HPA019125
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSRQIFPPESFADTEAGEELSGDGLVLPRASKLDE
FLSPEEEIDSTSDSTGSIYQNLQELKQKGRWCLLE
SLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQ
CPQALRCGSTRRCSSLNNLPSNIPRPQTQPPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -