HPA024503

OTUD6B antibody from Sigma-Aldrich
CGI-77, DUBA5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024503
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024503, RRID:AB_1854845
Product name
Anti-OTUD6B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024503
Antibody type
Polyclonal
Antigen
OTU domain-containing protein 6B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHV
EDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTA
Storage
-20C
Provider Type Product Number
- No reagents -