HPA003408

IFIT2 antibody from Atlas Antibodies
cig42, G10P2, GARG-39, IFI-54, IFI54, ISG-54K
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003408
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003408, RRID:AB_1079100
Product name
Anti-IFIT2
Provider product page
Atlas Antibodies - HPA003408
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RVCSILASLHALADQYEDAEYYFQKEFSKELTPVA
KQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQK
SREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFL
QELNEKMQQADEDSERGLESGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -