HPA003408

IFIT2 antibody from Sigma-Aldrich
cig42, G10P2, GARG-39, IFI-54, IFI54, ISG-54K
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003408
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003408, RRID:AB_1079100
Product name
Anti-IFIT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003408
Antibody type
Polyclonal
Antigen
Interferon-induced protein with tetratricopeptide repeats 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVCSILASLHALADQYEDAEYYFQKEFSKELTPVA
KQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQK
SREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFL
QELNEKMQQADEDSERGLESGS
Storage
-20C
Provider Type Product Number
- No reagents -