HPA016720

TMTC1 antibody from Sigma-Aldrich
ARG99, FLJ31400, FLJ41625, OLF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016720
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016720, RRID:AB_1858155
Product name
Anti-TMTC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016720
Antibody type
Polyclonal
Antigen
Transmembrane and TPR repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQ
PGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSP
LPPEPKSSGFPVSPRAVWSMMR
Storage
-20C
Provider Type Product Number
- No reagents -