HPA005543

IFI6 antibody from Sigma-Aldrich
6-16, FAM14C, G1P3, IFI-6-16, IFI616
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005543
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005543, RRID:AB_1849342
Product name
Anti-IFI6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005543
Antibody type
Polyclonal
Antigen
Interferon alpha-inducible protein 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AANSVAASLMSWSAILNGGGVPAGGLVATLQSLGA
GGSSVVIGNIGALMGYATHKYLDSEEDE
Storage
-20C
Provider Type Product Number
- No reagents -