H00000744-B01P

MPPED2 antibody from Abnova Corporation
239FB, C11orf8, D11S302E, dJ1024C24.1, dJ873F21.1, FAM1B, Hs.46638

Antibody data

Product number
H00000744-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000744-B01P, RRID:AB_1575603
Product name
MPPED2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00000744-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MPPED2 protein.
Antigen sequence
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSR
FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRT
DGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGN
LPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPS
VSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIY
GAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDIL
MTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRP
KLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPT
NPPIIFDLPNPQGS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -