Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003575 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003575, RRID:AB_1080378
- Product name
- Anti-TRIM22
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQE
RTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQ
KLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQ
RRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKK
LKSVFRV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references TRIM5α and TRIM22 are differentially regulated according to HIV-1 infection phase and compartment.
Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.
Association of TRIM22 with the type 1 interferon response and viral control during primary HIV-1 infection.
The human IFN-inducible p53 target gene TRIM22 colocalizes with the centrosome independently of cell cycle phase
Singh R, Patel V, Mureithi MW, Naranbhai V, Ramsuran D, Tulsi S, Hiramen K, Werner L, Mlisana K, Altfeld M, Luban J, Kasprowicz V, Dheda K, Abdool Karim SS, Ndung'u T
Journal of virology 2014 Apr;88(8):4291-303
Journal of virology 2014 Apr;88(8):4291-303
Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.
Carotenuto M, Pedone E, Diana D, de Antonellis P, Džeroski S, Marino N, Navas L, Di Dato V, Scoppettuolo MN, Cimmino F, Correale S, Pirone L, Monti SM, Bruder E, Zenko B, Slavkov I, Pastorino F, Ponzoni M, Schulte JH, Schramm A, Eggert A, Westermann F, Arrigoni G, Accordi B, Basso G, Saviano M, Fattorusso R, Zollo M
Scientific reports 2013;3:1351
Scientific reports 2013;3:1351
Association of TRIM22 with the type 1 interferon response and viral control during primary HIV-1 infection.
Singh R, Gaiha G, Werner L, McKim K, Mlisana K, Luban J, Walker BD, Karim SS, Brass AL, Ndung'u T, CAPRISA Acute Infection Study Team
Journal of virology 2011 Jan;85(1):208-16
Journal of virology 2011 Jan;85(1):208-16
The human IFN-inducible p53 target gene TRIM22 colocalizes with the centrosome independently of cell cycle phase
Petersson J, Lönnbro P, Herr A, Mörgelin M, Gullberg U, Drott K
Experimental Cell Research 2010 February;316(4):568-579
Experimental Cell Research 2010 February;316(4):568-579
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TRIM22 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line ASC TERT1 shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
- Sample type
- HUMAN