HPA023765

IPO8 antibody from Atlas Antibodies
IMP8, RANBP8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023765
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023765, RRID:AB_1851773
Product name
Anti-IPO8
Provider product page
Atlas Antibodies - HPA023765
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDL
DNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSED
QRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFEN
KGVLSAFNFGTVPSNN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -