HPA018439

IPO8 antibody from MilliporeSigma / Merck KGaA
IMP8, RANBP8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018439
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018439, RRID:AB_1851771
Product name
Anti-IPO8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018439
Antibody type
Polyclonal
Antigen
Importin-8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLG
HHDRKMCIIGLSILLELQNRPPAVDAVVGQIVPSI
LFLFLGLKQVCATRQLVNREDRSKAEKADMEENE
Storage
-20C
Provider Type Product Number
- No reagents -