HPA023765

IPO8 antibody from Sigma-Aldrich
IMP8, RANBP8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023765, RRID:AB_1851773
Product name
Anti-IPO8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023765
Antibody type
Polyclonal
Antigen
Importin-8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDL
DNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSED
QRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFEN
KGVLSAFNFGTVPSNN
Storage
-20C
Provider Type Product Number
- No reagents -