HPA020025

DNAJC24 antibody from MilliporeSigma / Merck KGaA
DPH4, JJJ3, ZCSL3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020025
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020025, RRID:AB_1847801
Product name
Anti-DNAJC24 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020025
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAVEQMPKKDWYSILGADPSANISDLKQKYQKLIL
MYHPDKQSTDVPAGTVEECVQKFIEIDQAWK
Storage
-20C
Provider Type Product Number
- No reagents -