HPA002916

EAPP antibody from Atlas Antibodies
BM036, C14orf11, FLJ20578
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002916
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002916, RRID:AB_1078715
Product name
Anti-EAPP
Provider product page
Atlas Antibodies - HPA002916
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEME
AELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRY
YDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDE
LLYDPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -