HPA003890
ADAR antibody from Atlas Antibodies
ADAR1, G1P1, IFI4
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA003890
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003890, RRID:AB_1078103
- Product name
- Anti-ADAR
- Provider product page
- Atlas Antibodies - HPA003890
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLN
TNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFV
YQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIG
ENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
MicroRNA Editing Facilitates Immune Elimination of HCMV Infected Cells
Nachmani D, Zimmermann A, Oiknine Djian E, Weisblum Y, Livneh Y, Khanh Le V, Galun E, Horejsi V, Isakov O, Shomron N, Wolf D, Hengel H, Mandelboim O, Gao S
PLoS Pathogens 2014 February;10(2)
ADAR-Related Activation of Adenosine-to-Inosine RNA Editing During Regeneration
Witman N, Behm M, Öhman M, Morrison J
Stem Cells and Development 2013 August;22(16):2254-2267
Mutations in ADAR1 cause Aicardi-Goutières syndrome associated with a type I interferon signature
Rice G, Kasher P, Forte G, Mannion N, Greenwood S, Szynkiewicz M, Dickerson J, Bhaskar S, Zampini M, Briggs T, Jenkinson E, Bacino C, Battini R, Bertini E, Brogan P, Brueton L, Carpanelli M, De Laet C, de Lonlay P, del Toro M, Desguerre I, Fazzi E, Garcia-Cazorla À, Heiberg A, Kawaguchi M, Kumar R, Lin J, Lourenco C, Male A, Marques W, Mignot C, Olivieri I, Orcesi S, Prabhakar P, Rasmussen M, Robinson R, Rozenberg F, Schmidt J, Steindl K, Tan T, van der Merwe W, Vanderver A, Vassallo G, Wakeling E, Wassmer E, Whittaker E, Livingston J, Lebon P, Suzuki T, McLaughlin P, Keegan L, O'Connell M, Lovell S, Crow Y
Nature Genetics 2012 September;44(11):1243-1248
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting ADAR or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting ADAR Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:196
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s1007
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s1008
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s1009
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R04101
- Appendix
- 565c9c16e5d38.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining relative intensity is presented
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and subset of glial cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-ADAR antibody HPA003890.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-ADAR antibody HPA003890.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-ADAR antibody HPA003890.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-ADAR antibody HPA003890.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-ADAR antibody HPA003890 (A) shows similar protein distribution across tissues to independent antibody HPA051519 (B).
- Antibody #2 product nr
- HPA051519
- Antibody provider
- Atlas Antibodies
- Show more
Enhanced validation
Supportive data in Antibodypedia
