Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021289 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021289, RRID:AB_1845286
- Product name
- Anti-BBS9
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALN
LNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLST
DAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELF
TNHRHLTAETPRPEVSPLQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references BBS mutations modify phenotypic expression of CEP290-related ciliopathies.
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
Zhang Y, Seo S, Bhattarai S, Bugge K, Searby CC, Zhang Q, Drack AV, Stone EM, Sheffield VC
Human molecular genetics 2014 Jan 1;23(1):40-51
Human molecular genetics 2014 Jan 1;23(1):40-51
The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome
Chamling X, Seo S, Searby C, Kim G, Slusarski D, Sheffield V, Dutcher S
PLoS Genetics 2014 February;10(2)
PLoS Genetics 2014 February;10(2)
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
Humbert MC, Weihbrecht K, Searby CC, Li Y, Pope RM, Sheffield VC, Seo S
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
- Sample type
- HUMAN