HPA021289

BBS9 antibody from Sigma-Aldrich
B1, PTHB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021289
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021289, RRID:AB_1845286
Product name
Anti-BBS9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021289
Antibody type
Polyclonal
Antigen
Protein PTHB1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALN
LNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLST
DAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELF
TNHRHLTAETPRPEVSPLQ
Storage
-20C
Provider Type Product Number
- No reagents -