HPA026545

KDM8 antibody from Sigma-Aldrich
FLJ13798, JMJD5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026545, RRID:AB_1852015
Product name
Anti-JMJD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026545
Antibody type
Polyclonal
Antigen
JmjC domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKW
SLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVN
EFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISI
PDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQ
NFLVQVM
Storage
-20C
Provider Type Product Number
- No reagents -