HPA004895

IRF3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004895
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004895, RRID:AB_1851887
Product name
Anti-IRF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004895
Antibody type
Polyclonal
Antigen
Interferon regulatory factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEAT
GAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDR
SKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGS
TSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEP
CPQ
Storage
-20C
Provider Type Product Number
- No reagents -