Antibody data

Product number
H00004634-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004634-M12, RRID:AB_1136966
Product name
MYL3 monoclonal antibody (M12), clone 4C2
Provider product page
Abnova Corporation - H00004634-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MYL3.
Antigen sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEV
EFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK
ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELN
TKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF
DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAG
QEDSNGCINYEAFVKHIMSS
Isotype
IgG
Antibody clone number
4C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -