HPA016564

antibody from Atlas Antibodies

Targeting: MYL3 CMH8, MLC1SB, MLC1V, VLC1

Antibody data

Submit

Validation data

Product number: HPA016564 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016564, RRID:AB_1854244
Product name: Anti-MYL3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDA SKIKIEFTPEQIEEFKEAFMLFDRTPKCEM
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYL3 protein structure - HPA016564 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and lymph node tissues using HPA016564 antibody. Corresponding MYL3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Sample type: HUMAN