HPA006221

LTBP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006221
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006221, RRID:AB_1853392
Product name
Anti-LTBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006221
Antibody type
Polyclonal
Antigen
Latent-transforming growth factor beta-binding protein, isoform 1S precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQ
GYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSF
QCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDC
INTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLC
G
Storage
-20C
Provider Type Product Number
- No reagents -