Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021652 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021652, RRID:AB_1858759
- Product name
- Anti-VPS13A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KCGLVMLNNLVKAFTEAATGSSADFVKDLAPFMIL
NSLGLTISVSPSDSFSVLNIPMAKSYVLKNGESLS
MDYIRTKDNDHFNAMTSLSSKLFFILLTPVNHSTA
DKIPLTKVGRRLYTVRHRESGVERSIVCQIDTVEG
SKKVTIRSPV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Interaction between VPS13A and the XK scramblase is important for VPS13A function in humans
XK is a partner for VPS13A: a molecular link between Chorea-Acanthocytosis and McLeod Syndrome
Human VPS13A is associated with multiple organelles and influences mitochondrial morphology and lipid droplet motility
Park J, Hu Y, Hollingsworth N, Miltenberger-Miltenyi G, Neiman A
Journal of Cell Science 2022;135(17)
Journal of Cell Science 2022;135(17)
XK is a partner for VPS13A: a molecular link between Chorea-Acanthocytosis and McLeod Syndrome
Park J, Neiman A, Brennwald P
Molecular Biology of the Cell 2020;31(22):2425-2436
Molecular Biology of the Cell 2020;31(22):2425-2436
Human VPS13A is associated with multiple organelles and influences mitochondrial morphology and lipid droplet motility
Yeshaw W, van der Zwaag M, Pinto F, Lahaye L, Faber A, Gómez-Sánchez R, Dolga A, Poland C, Monaco A, van IJzendoorn S, Grzeschik N, Velayos-Baeza A, Sibon O
eLife 2019;8
eLife 2019;8
No comments: Submit comment
No validations: Submit validation data