Antibody data

Product number
H00005917-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005917-M01A, RRID:AB_1204897
Product name
RARS monoclonal antibody (M01A), clone 1E9-2B5
Provider product page
Abnova Corporation - H00005917-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RARS.
Antigen sequence
MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCL
GASPNLEQLQEENLKLKYRLNILRKSLQAERNKPT
KNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPS
QQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAEN
ITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQL
TSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVG
HLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQF
GMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF
DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVS
RQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE
DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYD
TSDLAAIKQRLFEEKADMIIYVVDNGQSVHFQTIF
AAAQMIGWYDPKVTRVFHAGFGVVLGEDKKKFKTR
SGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEE
LNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLD
DRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR
ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLH
TLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKV
NMWRMLLCEAVAAVMAKGFDILGIKPVQRM
Isotype
IgM
Antibody clone number
1E9-2B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -