HPA003979

RARS1 antibody from Atlas Antibodies
DALRD1, RARS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003979, RRID:AB_1856083
Product name
Anti-RARS
Provider product page
Atlas Antibodies - HPA003979
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLI
AHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEE
EFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQEL
NKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGF
VQVDDGRKIV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -