Antibody data

Product number
ABIN502233
Provider
antibodies-online
Product name
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (N-Term) antibody
Provider product page
antibodies-online - ABIN502233
Antibody type
Polyclonal
Antigen
The immunogen for anti-GEM antibody: synthetic peptide directed towards the N terminal of human GEM
Description
Affinity Purified
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISS
ESGNT YYRVVLIGEQ
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -