HPA018083

BMPER antibody from Sigma-Aldrich
CRIM3, Cv2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018083
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018083, RRID:AB_1847343
Product name
Anti-BMPER antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018083
Antibody type
Polyclonal
Antigen
BMP-binding endothelial regulator protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCK
RKCSHPGGCDQGQEGCCEECLLRVPPEDIKVCKFG
NKIFQDGEMWSSINCTICACVKGRTECRNKQCIPI
SSCPQGKILNRKGCCPICTEKPGVCTVFGD
Storage
-20C
Provider Type Product Number
- No reagents -