HPA003980

IL18 antibody from Atlas Antibodies
IGIF, IL-18, IL-1g, IL1F4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003980
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003980, RRID:AB_1234569
Product name
Anti-IL18
Provider product page
Atlas Antibodies - HPA003980
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLES
DYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCE
KISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
SVPGHDNKMQF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -