HPA003980

IL18 antibody from Sigma-Aldrich
IGIF, IL-18, IL-1g, IL1F4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003980, RRID:AB_1851670
Product name
Anti-IL18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003980
Antibody type
Polyclonal
Antigen
Interleukin-18 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLES
DYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCE
KISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
SVPGHDNKMQF
Storage
-20C
Provider Type Product Number
- No reagents -