HPA022970

RUFY3 antibody from Atlas Antibodies
KIAA0871, RIPx, Singar1, ZFYVE30
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022970
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022970, RRID:AB_1856307
Product name
Anti-RUFY3
Provider product page
Atlas Antibodies - HPA022970
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQ
SSDLGVKQKSELNSRLEEKTNQMAATIKQLEQRLR
QAERSRQSAELDNRLFKQDFGDKINSLQLEVEELT
RQRNQLEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -