HPA022031

KIF9 antibody from Sigma-Aldrich
MGC104186
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022031
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022031, RRID:AB_1852502
Product name
Anti-KIF9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022031
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMAL
KPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVL
PEGPDSISFYNAKVKI
Storage
-20C
Provider Type Product Number
- No reagents -