HPA019105

HAPLN1 antibody from Sigma-Aldrich
CRTL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019105, RRID:AB_1850496
Product name
Anti-HAPLN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019105
Antibody type
Polyclonal
Antigen
Hyaluronan and proteoglycan link protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVF
SHRGGNVTLPCKFYRDPTAFGSGIH
Storage
-20C
Provider Type Product Number
- No reagents -