HPA002933

TRAF3 antibody from Atlas Antibodies
CAP-1, CD40bp, CRAF1, LAP1, RNF118
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002933
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002933, RRID:AB_1080352
Product name
Anti-TRAF3
Provider product page
Atlas Antibodies - HPA002933
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSSPKCTACQESIVKDKVFKDNCCKREILALQIYC
RNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPD
CKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMI
ALQKHEDTDCPCVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -