HPA002933

TRAF3 antibody from Sigma-Aldrich
CAP-1, CD40bp, CRAF1, LAP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002933, RRID:AB_1080352
Product name
Anti-TRAF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002933
Antibody type
Polyclonal
Antigen
TNF receptor-associated factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSSPKCTACQESIVKDKVFKDNCCKREILALQIYC
RNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPD
CKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMI
ALQKHEDTDCPCVV
Storage
-20C
Provider Type Product Number
- No reagents -